PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000202128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 521aa    MW: 57407.5 Da    PI: 7.8558
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000202128genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB160.13.4e-5023117296
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    +eqd++lPianv+rimk++lP nakisk+aket+qec+sefisfvt+eas+kc++e+rkt+ngdd++wal  lGf+dy  pl+ yl++yre e++
  MDP0000202128  23 KEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTVNGDDVCWALRALGFDDYTGPLRRYLHRYREQERD 117
                    89*******************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-4721119IPR009072Histone-fold
SuperFamilySSF471137.76E-3725140IPR009072Histone-fold
PfamPF008085.3E-262892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.4E-145674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.4E-147593No hitNo description
PRINTSPR006154.4E-1494112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MVDNNNPGAS GAAKDDDIDG GIKEQDQLLP IANVGRIMKQ ILPPNAKISK EAKETMQECA  60
SEFISFVTGE ASEKCRKERR KTVNGDDVCW ALRALGFDDY TGPLRRYLHR YREQERDGIS  120
SEANNNINED HQRISINNIP HTXGSNYFKG SSTSGYLMGY VDGTLLCPPK HVANSTTVNP  180
XYTAWVQQDQ MILSWINGSL XASVLSVVAS KEQLELHGKL LSKGATVNAF XASRGRGGXP  240
RGGXRGHASN RGGNQRAYNN RNNTNIPNNQ GHPXLDCYQR MNAAFEGRIP TKXLSXMTSS  300
PITLNKQQNG SWLLDTGANA HITPDIQNLA HXKEYNGNDG XGGVGKSTKL PFNVSESMSQ  360
FXLQLIHSDV WXSPIQSNEG SLDHQGYRCL DMSTRRVYLS HHVLFDDDFF PFKGLTSPSE  420
SVASLVTNLL PDLLFTFPLS TASPESPILN XPPPQISPNS NLYASIPSYP DPTTSQPNTL  480
PTXLTNFLLS LRVSIRQSSI RSGGMIWCRN SMPYNGVEPR V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-3822113192Transcription factor HapC (Eurofung)
4g92_B5e-3822113192Transcription factor HapC (Eurofung)
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-49nuclear factor Y, subunit B5